Online Inquiry
NFAM1 Antibody
SPA-08046
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | NFAM1 |
| Gene Abbr. | NFAM1 |
| Gene ID | 150372 |
| Full Name | NFAT activating protein with ITAM motif 1 |
| Alias | CNAIP |
| Introduction | NFAM1 is a ~30 kDa transmembrane ITAM-containing glycoprotein of the Ig superfamily that activates the NFAT family of transcription factors. NFAM1 is expressed in leukocytes, predominantly splenic B and T cells, and is involved in B cell activation and signaling. The 121 aa human NFAM1 extracellular domain contains one V‑type Ig-like domain and shows 45% aa identity with mouse NFAM1. The 86 aa cytoplasmic domain contains one ITAM consensus sequence. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: NKKRMRGPGKDPTRKCPDPRSASSPKQHPSESVYTALQRRETEVYACIENEDGSSPTAKQSPLSQERPHRFEDDGELNLVYE. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:50-1:200) |
| Reactivity | Human |
| Specificity | Specificity of human NFAM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.