Online Inquiry
Neurobeachin Antibody
SPA-07906
| Size | Price |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Neurobeachin |
| Gene Abbr. | NBEA |
| Gene ID | 26960 |
| Full Name | neurobeachin |
| Alias | BCL8B, LYST2 |
| Introduction | Neurobeachin binds to type II regulatory subunits of protein kinase A and anchors/targets them to the membrane. It may anchor the kinase to cytoskeletal and/or organelle-associated proteins. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 3F11 |
| Isotype | IgG2A Kappa |
| Immunogen | NBEA (NP_056493.3, 1133 a.a. ~ 1220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ADEKEDLPNSSTSFLFDKIPKQEEKLLPELSSNHIIPNIQDTQVHLGVSDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSI. |
| Usage | |
|---|---|
| Application | WB, ELISA, IF |
| Dilutions | Western Blot (1:100-1:2000); ELISA (1:100-1:2000); Immunofluorescence (1:10-1:2000) |
| Reactivity | Human |
| Specificity | This product is specific for Human NBEA monoclonal antibody (M01), clone 3F11 [Gene ID: 26960]. |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.