NELF Antibody - CD BioSciences

service-banner

NELF Antibody

NELF Antibody

SPA-07894

Size Price
0.1 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name NELF
Gene Abbr. NSMF
Gene ID 26012
Full Name NMDA receptor synaptonuclear signaling and neuronal migration factor
Alias HH9, NELF
Introduction NELF influences outgrowth of olfactory axons and migration of LHRH neurons.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to NELF(nasal embryonic LHRH factor) The peptide sequence was selected from the N terminal of NELF. Peptide sequence GAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADA. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Dilutions Western Blot (1:100-1:2000)
Reactivity Human, Mouse, Rat, Bovine, Canine, Equine
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.