Online Inquiry
NCAM-1/CD56 Antibody
SPA-07846
| Size | Price |
| 20 µg | Online Inquiry |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | NCAM-1 |
| Gene Abbr. | NCAM1 |
| Gene ID | 4684 |
| Full Name | neural cell adhesion molecule 1 |
| Alias | CD56, MSK39, NCAM |
| Introduction | CD56, a 175-220KDa glycoprotein, is a member of the Ig super family. It is expressed as three major isoforms and consists of five Ig-like domains and two Fibronectin-type III domains in the extracellular region. The 135kDa isoform is the basic molecule which is glycosylated or sialylated to produce the mature species. CD56 is widely expressed in nervous system, on NK cells and a specific set of Tcells. CD56+ NK cells and Tcells are unique in their ability to mediate cell-mediated cytotoxicity against certain tumor cell targets without MHC restriction. Other physiological functions of CD56 include mediating cell adhesion through homophilic and heterophilic interaction and activating intracellular signaling pathways resulting in neutrite extension and fasciculation, migration and synapses formation in brain. CD56 is also vital for neuronal development and plasticity in adult brain. It is used as a tumor marker in various cancers such as NK lymphomas and Merkel cell carcinoma. NCAM is expressed on most neuroectodermal derived lines, tissues, and neoplasms such as retinoblastoma, medulloblastoma, astrocytoma, and neuroblastoma. It is also expressed on some mesodermally derived tumors such as rhabdomyosarcoma and also on natural killer cells. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: DSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAK. |
| Usage | |
|---|---|
| Application | WB, IF, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:200-1:500) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human NCAM-1/CD56 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.