Online Inquiry
MYH6 Antibody
SPA-07785
Size | Price |
0.1 mg | Online Inquiry |
0.025 mg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | MYH6 |
Gene Abbr. | MYH6 |
Gene ID | 4624 |
Full Name | myosin heavy chain 6 |
Alias | ASD3, CMD1EE, CMH14, MYHC, MYHCA |
Introduction | Myosin is a highly conserved, ubiquitously expressed protein that hydrolyzes ATP, and this reaction provides the energy required for muscle contraction and that interacts with Actin to generate the force for cellular movements. It is a hexameric protein composed of four light chains and two heavy chains, each containing an actin-binding site and an ATP hydrolysis site. The heavy chains are encoded by the MYH gene family and were first isolated from a human fetal skeletal muscle and are the major determinant in the speed of contraction of skeletal muscle. Cardiac myosin exists as two isoforms in humans, a-cardiac myosins and b-cardiac myosins. These two isoforms are expressed in different amounts in the human heart. b-cardiac myosins is the predominant form during normal physiology while the a-isoform contributes for approximately 7% of the total myosin. Mutations of the MYH genes are associated with several different dilated and hypertrophic cardiomyopathies. |
Product Details | |
---|---|
Host | Mouse |
Clonality | Monoclonal |
Clone No. | CL2162 |
Isotype | IgG2B |
Immunogen | Recombinant Protein corresponding to amino acids:QVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA. |
Usage | |
---|---|
Application | WB, IHC |
Dilutions | Western Blot (1 µg/mL); Immunohistochemistry (1:5000-1:10000) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human MYH6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.