Online Inquiry
MUL1 Antibody
SPA-07758
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | MUL1 |
| Gene Abbr. | MUL1 |
| Gene ID | 79594 |
| Full Name | mitochondrial E3 ubiquitin protein ligase 1 |
| Alias | C1orf166, GIDE, MAPL, MULAN, RNF218 |
| Introduction | MUL1 is an E3 ubiquitin-protein ligase that plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, MUL1 activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to C1ORF166 The peptide sequence was selected from the middle region of C1ORF166 (NP_078820). Peptide sequence GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (0.2-1 µg/mL) |
| Reactivity | Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.