Online Inquiry
MRGX4 Antibody
SPA-07720
| Size | Price |
| 0.05 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | MRGX4 |
| Gene Abbr. | MRGPRX4 |
| Gene ID | 117196 |
| Full Name | MAS related GPR family member X4 |
| Alias | GPCR, MRGX4, SNSR6 |
| Introduction | MRGX3 is an Orphan-A GPCR with an unknown ligand highly similar to other MRG receptors. The MRG/SNSR family has been shown to be expressed predominantly, if not solely, in subsets of dorsal root ganglion nociceptive sensory neurons |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Immunogen | Synthetic peptide directed towards the C-terminal region of MRGX4. Peptide sequence: FFVGSFRQRQNRQNLKLVLQRALQDKPEVDKGEGQLPEESLELSGSRLGP The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Reactivity | Human |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS, 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.