Online Inquiry
MLK2 Antibody
SPA-07660
Size | Price |
0.1 mL | Online Inquiry |
25 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | MLK2 |
Gene Abbr. | MAP3K10 |
Gene ID | 4294 |
Full Name | mitogen-activated protein kinase kinase kinase 10 |
Alias | MEKK10, MLK2, MST |
Introduction | MLK2 (mixed lineage kinase 2; also MST and MAP3K10) is a member of the STE Ser/Thr kinase family of enzymes. It is expressed in neurons, lymphoid tissue, and skeletal muscle, where it participates in apoptosis. Human MLK2 is 954 amino acids (aa) in length. It contains an N-terminal SH3 domain (aa 23‑76), followed by a kinase domain that likely acts to phosphorylate Ser/Thr (aa 99‑355), two Leu-zipper segments that mediate homodimerization (aa 384‑419) and a C-terminal Ser/Thr/Pro-rich region that undergoes phosphorylation at multiple sites (aa 497‑954). There is one splice variant that shows an in-frame 16 aa substitution for the 16 aa between aa 465‑480. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: LPSGFEHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWSRGGPPKKEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLGEGSKQWSSS. |
Usage | |
---|---|
Application | WB, IF, IHC |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:200-1:500) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human MLK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.