Online Inquiry
Methionine Aminopeptidase 2/METAP2 Antibody
SPA-07539
Size | Price |
100 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Methionine Aminopeptidase |
Gene Abbr. | METAP2 |
Gene ID | 10988 |
Full Name | methionyl aminopeptidase 2 |
Alias | MAP2, MNPEP, p67eIF2 |
Introduction | The human METAP2 gene encodes Methionine Aminopeptidase 2, a member of the M24 family of metalloproteases. METAPs catalyze the removal of the initiator methionine residue from nascent peptides and are essential for cell growth. METAP2 plays an important role in the development of different types of cancer and has been a novel target for developing anti-cancer drugs. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Immunogen | Synthetic peptide directed towards the N terminal region of human Methionine Aminopeptidase 2/METAP2. Peptide sequence: ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR The peptide sequence for this immunogen was taken from within the described region. |
Usage | |
---|---|
Application | WB, IHC |
Reactivity | Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit |
Storage & Handling | |
---|---|
Storage Buffer | PBS, 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.