Methionine Aminopeptidase 2/METAP2 Antibody - CD BioSciences

service-banner

Methionine Aminopeptidase 2/METAP2 Antibody

Methionine Aminopeptidase 2/METAP2 Antibody

SPA-07539

Size Price
100 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name Methionine Aminopeptidase
Gene Abbr. METAP2
Gene ID 10988
Full Name methionyl aminopeptidase 2
Alias MAP2, MNPEP, p67eIF2
Introduction The human METAP2 gene encodes Methionine Aminopeptidase 2, a member of the M24 family of metalloproteases. METAPs catalyze the removal of the initiator methionine residue from nascent peptides and are essential for cell growth. METAP2 plays an important role in the development of different types of cancer and has been a novel target for developing anti-cancer drugs.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the N terminal region of human Methionine Aminopeptidase 2/METAP2. Peptide sequence: ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB, IHC
Reactivity Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Storage & Handling
Storage Buffer PBS, 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.