Melatonin R1A/MT1/MTNR1A Antibody - CD BioSciences

service-banner

Melatonin R1A/MT1/MTNR1A Antibody

Melatonin R1A/MT1/MTNR1A Antibody

SPA-07733

Size Price
100 µL Online Inquiry
20 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name MTNR1A
Gene Abbr. MTNR1A
Gene ID 4543
Full Name melatonin receptor 1A
Alias MEL-1A-R, MT1
Introduction This gene encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This receptor is a G-protein coupled, 7-transmembrane receptor that is responsible for melatonin effects on mammalian circadian rhythm and reproductive alterations affected by day length. The receptor is an integral membrane protein that is readily detectable and localized to two specific regions of the brain. The hypothalamic suprachiasmatic nucleus appears to be involved in circadian rhythm while the hypophysial pars tuberalis may be responsible for the reproductive effects of melatonin. [provided by RefSeq]
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the C-terminal region of Melatonin R1A/MT1/MTNR1A. Peptide sequence: GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVV The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Reactivity Human, Canine
Storage & Handling
Storage Buffer PBS, 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.