Melanocortin-5 R/MC5R Antibody - CD BioSciences

service-banner

Melanocortin-5 R/MC5R Antibody

Melanocortin-5 R/MC5R Antibody

SPA-07269

Size Price
0.1 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name MC5R
Gene Abbr. MC5R
Gene ID 4161
Full Name melanocortin 5 receptor
Alias MC2
Introduction The melanocortin family comprises the alpha-, beta- and gamma-melanocyte stimulating hormones (MSH) and adrenocorticotrophin. The receptors for these hormones are seven-transmembrane, G protein-coupled proteins that activate adenylyl cyclase. Five melanocortin receptors have been cloned and shown to exhibit different affinities and patterns of expression. MC1-R (MSH-R) is expressed in melanocytes and corticoadrenal tissue. MC2-R is the ACTH receptor and is expressed primarily in the adrenal cortex. MC3-R has been found in specific regions of the brain and is also expressed in placenta and gut. MC4-R is expressed primarily in brain, while MC5-R is expressed at low levels in most tissues.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDM.
Usage
Application IHC
Dilutions Immunohistochemistry (1:1000-1:2500)
Reactivity Human
Specificity Specificity of human Melanocortin-5 R/MC5R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.