Online Inquiry
Melanocortin-5 R/MC5R Antibody
SPA-07269
Size | Price |
0.1 mg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | MC5R |
Gene Abbr. | MC5R |
Gene ID | 4161 |
Full Name | melanocortin 5 receptor |
Alias | MC2 |
Introduction | The melanocortin family comprises the alpha-, beta- and gamma-melanocyte stimulating hormones (MSH) and adrenocorticotrophin. The receptors for these hormones are seven-transmembrane, G protein-coupled proteins that activate adenylyl cyclase. Five melanocortin receptors have been cloned and shown to exhibit different affinities and patterns of expression. MC1-R (MSH-R) is expressed in melanocytes and corticoadrenal tissue. MC2-R is the ACTH receptor and is expressed primarily in the adrenal cortex. MC3-R has been found in specific regions of the brain and is also expressed in placenta and gut. MC4-R is expressed primarily in brain, while MC5-R is expressed at low levels in most tissues. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDM. |
Usage | |
---|---|
Application | IHC |
Dilutions | Immunohistochemistry (1:1000-1:2500) |
Reactivity | Human |
Specificity | Specificity of human Melanocortin-5 R/MC5R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.