Online Inquiry
Melanocortin-1 R/MC1R Antibody
SPA-07262
Size | Price |
0.05 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | MC1R |
Gene Abbr. | MC1R |
Gene ID | 4157 |
Full Name | melanocortin 1 receptor |
Alias | CMM5, MSH-R, SHEP2 |
Introduction | MC1R, a Melanocortin Receptor, mediates the effects of melanocyte-stimulating hormone (MSH) and adrenocorticotropic hormone (ACTH). MSH and its receptor, MC1R, are key regulators of melanogenesis. They control the relative proportions of red pheomelanin and black photoprotective eumelanin in the skin by increasing the production of eumelanin. Non-functional, truncated forms of the receptor lead to lighter coat color in animals. In contrast, constitutively active receptors lead to darker color. Pheomelanin generates free radicals in response to UV radiation, and elevated levels of pheomelanin have been associated with higher risk of UV-induced skin damage. Therefore, MC1R is a major determinant of sun sensitivity and genetic risk for melanoma and other skin cancers. Expression of melanocortin 1 receptor has been reported primarily in adrenal, skin, and testis. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Immunogen | Synthetic peptide directed towards the C-terminal region of Melanocortin-1 R/MC1R. Peptide sequence: CPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAFHSQELRRTLKEVLTCS The peptide sequence for this immunogen was taken from within the described region. |
Usage | |
---|---|
Application | WB |
Reactivity | Human, Rat, Porcine, Rabbit |
Storage & Handling | |
---|---|
Storage Buffer | PBS, 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.