Melanocortin-1 R/MC1R Antibody - CD BioSciences

service-banner

Melanocortin-1 R/MC1R Antibody

Melanocortin-1 R/MC1R Antibody

SPA-07262

Size Price
0.05 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name MC1R
Gene Abbr. MC1R
Gene ID 4157
Full Name melanocortin 1 receptor
Alias CMM5, MSH-R, SHEP2
Introduction MC1R, a Melanocortin Receptor, mediates the effects of melanocyte-stimulating hormone (MSH) and adrenocorticotropic hormone (ACTH). MSH and its receptor, MC1R, are key regulators of melanogenesis. They control the relative proportions of red pheomelanin and black photoprotective eumelanin in the skin by increasing the production of eumelanin. Non-functional, truncated forms of the receptor lead to lighter coat color in animals. In contrast, constitutively active receptors lead to darker color. Pheomelanin generates free radicals in response to UV radiation, and elevated levels of pheomelanin have been associated with higher risk of UV-induced skin damage. Therefore, MC1R is a major determinant of sun sensitivity and genetic risk for melanoma and other skin cancers. Expression of melanocortin 1 receptor has been reported primarily in adrenal, skin, and testis.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the C-terminal region of Melanocortin-1 R/MC1R. Peptide sequence: CPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAFHSQELRRTLKEVLTCS The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Reactivity Human, Rat, Porcine, Rabbit
Storage & Handling
Storage Buffer PBS, 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.