Online Inquiry
MED14 Antibody
SPA-07345
| Size | Price |
| 0.1 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | MED14 |
| Gene Abbr. | MED14 |
| Gene ID | 9282 |
| Full Name | mediator complex subunit 14 |
| Alias | CRSP150, CRSP2, CSRP, CXorf4, DRIP150 |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Immunogen | Synthetic peptide directed towards the middle region of human MED14. Peptide sequence: AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB, ChIP |
| Reactivity | Human |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS, 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.