Matriptase/ST14 Antibody - CD BioSciences

service-banner

Matriptase/ST14 Antibody

Matriptase/ST14 Antibody

SPA-07241

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name Matriptase
Gene Abbr. ST14
Gene ID 6768
Full Name suppression of tumorigenicity 14
Alias ARCI11, HAI, MT-SP1, MTSP1, PRSS14
Introduction The protein encoded by this gene is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to ST14(suppression of tumorigenicity 14 (colon carcinoma)) The peptide sequence was selected from the C terminal of ST14 (AAH18146). Peptide sequence SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB, IHC
Dilutions Western Blot (0.25 µg/mL); Immunohistochemistry (1:10-1:500)
Reactivity Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.