Online Inquiry
Matriptase/ST14 Antibody
SPA-07241
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Matriptase |
Gene Abbr. | ST14 |
Gene ID | 6768 |
Full Name | suppression of tumorigenicity 14 |
Alias | ARCI11, HAI, MT-SP1, MTSP1, PRSS14 |
Introduction | The protein encoded by this gene is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Synthetic peptides corresponding to ST14(suppression of tumorigenicity 14 (colon carcinoma)) The peptide sequence was selected from the C terminal of ST14 (AAH18146). Peptide sequence SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT. The peptide sequence for this immunogen was taken from within the described region. |
Usage | |
---|---|
Application | WB, IHC |
Dilutions | Western Blot (0.25 µg/mL); Immunohistochemistry (1:10-1:500) |
Reactivity | Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit |
Storage & Handling | |
---|---|
Storage Buffer | PBS and 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.