Online Inquiry
MASP2 Antibody
SPA-07233
| Size | Price |
| 100 µL | Online Inquiry |
| 20 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | MASP2 |
| Gene Abbr. | MASP2 |
| Gene ID | 10747 |
| Full Name | mannan binding lectin serine peptidase 2 |
| Alias | MAP19, MASP-2, MASP1P1, sMAP |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to MASP2(mannan-binding lectin serine peptidase 2) The peptide sequence was selected from the N terminal of MASP2. Peptide sequence FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB, IF, IHC |
| Dilutions | Western Blot (0.2-1 µg/mL); Immunofluorescence (1:10-1:500); Immunohistochemistry (1:10-1:500) |
| Reactivity | Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.