Online Inquiry
MAP4K5 Antibody
SPA-07198
| Size | Price |
| 100 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | MAP4K5 |
| Gene Abbr. | MAP4K5 |
| Gene ID | 11183 |
| Full Name | mitogen-activated protein kinase kinase kinase kinase 5 |
| Alias | GCKR, KHS, KHS1, MAPKKKK5 |
| Introduction | This gene encodes a member of the serine/threonine protein kinase family, that is highly similar to yeast SPS1/STE20 kinase. Yeast SPS1/STE20 functions near the beginning of the MAP kinase signal cascades that is essential for yeast pheromone response. This kinase was shown to activate Jun kinase in mammalian cells, which suggested a role in stress response. Two alternatively spliced transcript variants encoding the same protein have been described for this gene. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to MAP4K5(mitogen-activated protein kinase kinase kinase kinase 5) The peptide sequence was selected from the middle region of MAP4K5. Peptide sequence QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:100-1:2000) |
| Reactivity | Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.