Online Inquiry
MAP3K15 Antibody
SPA-07183
| Size | Price |
| 100 µL | Online Inquiry |
| 20 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | MAP3K15 |
| Gene Abbr. | MAP3K15 |
| Gene ID | 389840 |
| Full Name | mitogen-activated protein kinase kinase kinase 15 |
| Alias | ASK3, bA723P2.3 |
| Introduction | MAP3K15 is a component of a protein kinase signal transduction cascade. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to MAP3K15(mitogen-activated protein kinase kinase kinase 15) The peptide sequence was selected from the middle region of MAP3K15. Peptide sequence TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:100-1:2000) |
| Reactivity | Human |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.