Online Inquiry
MAP3K13 Antibody
SPA-07178
Size | Price |
0.1 mL | Online Inquiry |
25 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | MAP3K13 |
Gene Abbr. | MAP3K13 |
Gene ID | 9175 |
Full Name | mitogen-activated protein kinase kinase kinase 13 |
Alias | LZK, MEKK13, MLK |
Introduction | The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase contains a dual leucine-zipper motif, and has been shown to form dimers/oligomers through its leucine-zipper motif. This kinase can phosphorylate and activate MAPK8/JNK, MAP2K7/MKK7, which suggests a role in the JNK signaling pathway. [provided by RefSeq] |
Product Details | |
---|---|
Host | Mouse |
Clonality | Monoclonal |
Clone No. | 4H7 |
Isotype | IgG2A Kappa |
Immunogen | MAP3K13 (NP_004712.1, 711 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSLDIPSAEPVGRSPDLSKSPAHNPLLENAQSSEKTEENEFSGCRSESSLGTSHLGTPPALPRKTRPLQK. |
Usage | |
---|---|
Application | WB, ELISA, IF |
Dilutions | Western Blot (1:500) |
Reactivity | Human |
Specificity | MAP3K13 - mitogen-activated protein kinase kinase kinase 13. |
Storage & Handling | |
---|---|
Storage Buffer | In 1X PBS, pH 7.4. |
Preservative | No Preservative |
Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.