Online Inquiry
MAP3K12 Antibody
SPA-07175
| Size | Price |
| 0.1 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | MAP3K12 |
| Gene Abbr. | MAP3K12 |
| Gene ID | 7786 |
| Full Name | mitogen-activated protein kinase kinase kinase 12 |
| Alias | DLK, MEKK12, MUK, ZPK, ZPKP1 |
| Introduction | Mitogen-activated protein kinase kinase kinase 12 (MAP3K12) is a MAP kinase kinase kinase enzyme belonging to the serine/threonine protein kinase family. Located on human chromosome 12q13, it regulates the activity of various MAPKKs such as MAPKK7 and hence activating C-Jun N-terminal Kinase (JNK/SAPK). MAP3K12 associates with scaffold proteins, JIPs, which also interacts with MAPKK7 and JNK/SAPK. MAP3K12 protein is associated with dotted structures that are regularly located with golgi apparatus and also along the microtubules. This protein contains two leucine-zipper-like motifs and interaction of MAP3K12-binding inhibitory protein with one of these motifs deactivates this protein and induces activation of SAPK/JNK. MAP3K12 is also implicated in regulating radial cell migration via microtubule-based events. It has been reported that ectopic expression of this protein in neuronal precursor cells allows these cells to migrate from the ventricular zone and differentiate into neural cells. MAP3K12 was identified as a signaling molecule that is required for the regulation of keratinocyte terminal differentiation and cornification. While MAP3K12 is found in the epidermis, it is highly restricted to the neuronal cells in the central, peripheral and autonomic nervous systems. More specifically, it is localized in the axons of these cells. It has been shown that over-expression of MAP3K12 in cos-1 cells impairs the radial organization of microtubules without massive depolymerization. In humans, MAP3K12 is approximately a 68kDa protein (567 amino acids). In rat and mouse this protein weighs 107kDa (888 amino acids). |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to the following amino acid sequence: LLHGNTMEKLIKKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDL. |
| Usage | |
|---|---|
| Application | IF |
| Dilutions | Immunofluorescence (0.25-2 µg/mL) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human MAP3K12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.