M-Cadherin/Cadherin-15 Antibody - CD BioSciences

service-banner

M-Cadherin/Cadherin-15 Antibody

M-Cadherin/Cadherin-15 Antibody

SPA-07122

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name M-Cadherin
Gene Abbr. CDH15
Gene ID 1013
Full Name cadherin 15
Alias CDH14, CDH3, CDHM, MCAD, MRD3
Introduction CDH-15 (Cadherin 15; also M-cadherin, Muscle cadherin and Cadherin-14) is a 125-127 kDa atypical member of the classical cadherin family, cadherin superfamily of molecules. It is expressed by muscle satellite cells, cells of the embryonic myotome, and hematopoietic bone marrow stem cells. CDH-15 appears to bind homotypically in trans, thus allowing for the identification and subsequent fusion of myoblast precursors, particularly those in slow-twitch (or red fiber) muscles. This is accompanied by a downregulation of mitochondrial induced apoptosis. Mouse CDH-15 is synthesized as a 784 amino acid (aa) preproprecursor. It contains a 21 aa signal sequence, a 38 aa propeptide, and a 725 aa mature region. The mature region is expressed as a type I transmembrane glycoprotein that possesses a 546 aa extracellular region (aa 60-605) and a 159 aa cytoplasmic domain (aa 626-784). The extracellular region shows five consecutive cadherin domains. Over aa 22-605, mouse CDH-15 shares 88% and 97% aa sequence identity with human and rat CDH-15, respectively.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: LSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVAT.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
Reactivity Human
Specificity Specificity of human M-Cadherin/Cadherin-15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.