Online Inquiry
M-Cadherin/Cadherin-15 Antibody
SPA-07121
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | M-Cadherin |
| Gene Abbr. | CDH15 |
| Gene ID | 1013 |
| Full Name | cadherin 15 |
| Alias | CDH14, CDH3, CDHM, MCAD, MRD3 |
| Introduction | CDH-15 (Cadherin 15; also M-cadherin, Muscle cadherin and Cadherin-14) is a 125-127 kDa atypical member of the classical cadherin family, cadherin superfamily of molecules. It is expressed by muscle satellite cells, cells of the embryonic myotome, and hematopoietic bone marrow stem cells. CDH-15 appears to bind homotypically in trans, thus allowing for the identification and subsequent fusion of myoblast precursors, particularly those in slow-twitch (or red fiber) muscles. This is accompanied by a downregulation of mitochondrial induced apoptosis. Mouse CDH-15 is synthesized as a 784 amino acid (aa) preproprecursor. It contains a 21 aa signal sequence, a 38 aa propeptide, and a 725 aa mature region. The mature region is expressed as a type I transmembrane glycoprotein that possesses a 546 aa extracellular region (aa 60-605) and a 159 aa cytoplasmic domain (aa 626-784). The extracellular region shows five consecutive cadherin domains. Over aa 22-605, mouse CDH-15 shares 88% and 97% aa sequence identity with human and rat CDH-15, respectively. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: TFSARDPDTEQLQRLSYSKDYDPEDWLQVDAATGRIQTQHVLSPASPFLKGGWYRAIVLAQDDASQPRTATGTLSIEILEVNDHAPVLAPPPPGSLCSEPHQGPGLLLGATDEDLPPHGAPFHFQLSPRLPELGRNWSLSQVNVSH. |
| Usage | |
|---|---|
| Application | IF, IHC |
| Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:50-1:200) |
| Reactivity | Human |
| Specificity | Specificity of human M-Cadherin/Cadherin-15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.