Online Inquiry
Lymphotoxin beta/TNFSF3 Antibody
SPA-07103
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Lymphotoxin beta |
| Gene Abbr. | LTB |
| Gene ID | 4050 |
| Full Name | lymphotoxin beta |
| Alias | TNFC, TNFSF3, TNLG1C, p33 |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Immunogen | Synthetic peptide directed towards the C-terminal region of Human Lymphotoxin beta/TNFSF3. Peptide sequence: PELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNIS The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Reactivity | Human, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS, 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.