Lymphotoxin beta R/TNFRSF3 Antibody - CD BioSciences

service-banner

Lymphotoxin beta R/TNFRSF3 Antibody

Lymphotoxin beta R/TNFRSF3 Antibody

SPA-07066

Size Price
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name LTBR
Gene Abbr. LTBR
Gene ID 4055
Full Name lymphotoxin beta receptor
Alias D12S370, LT-BETA-R, TNF-R-III, TNFCR, TNFR-RP
Introduction Lymphotoxin beta receptor (LT beta R), also known as TNF RIII and TNF R-related protein (TNF Rrp) is a member of the TNF receptor superfamily, designated TNFRSF3. Human LT beta R cDNA encodes a 435 amino acid (aa) residue type I membrane protein with a putative 30 aa residue signal peptide, a 193 aa residue extracellular domain and a 171 aa residue cytoplasmic domain. The extracellular domain of LT beta R contains four cysteine-rich motifs characteristic of the TNF receptor superfamily. The cytoplasmic region of LT beta R shares little sequence similarity with other TNF receptor family members, suggesting that different signaling mechanisms may be used. LT beta R is expressed in a variety of tissues including visceral and lymphoid tissues. LT beta R is also expressed by cell lines of monocytic, epithelial, and fibroblastic origins but not by T and B lymphocytes. Human and mouse LT beta R share 76% aa sequence homology. The TNF family ligands that have been shown to bind and activate LT beta R include LIGHT (also a ligand for HVEM) and the heterotrimeric lymphotoxin LT alpha 1/ beta 2 or LT alpha 2/ beta 1. Depending on the cell type, activation of LT beta R has been shown to induce NF kappa B activation, chemokine production, growth arrest, and apoptosis. In vivo, LT beta R has been shown to play a critical role in controlling cellular immune functions and lymphoid organogenesis.

Zhai, Y. et al. (1998) J. Clin. Invest. 102:1142.
Rennert, P.D. et al. (1998) Immunity 9:71.
Degli-Esposti, M.A. et al. (1997) J. Immunol 158:1756.
Mackay, F. et al. (1996) J. Biol. Chem. 271:8618.
Crowe, P.D. et al. (1994) Science 264:707.
Product Details
Host Mouse
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen LTBR (NP_002333.1, 1 a.a. - 435 a.a.) full-length human protein. MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD.
Usage
Application WB
Reactivity Human
Storage & Handling
Storage Buffer PBS (pH 7.4).
Preservative No Preservative
Storage Temp. Aliquot and store at -20 °C or -80 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.