Online Inquiry
LTK Antibody
SPA-07073
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | LTK |
| Gene Abbr. | LTK |
| Gene ID | 4058 |
| Full Name | leukocyte receptor tyrosine kinase |
| Alias | TYK1 |
| Introduction | LTK (Leukocyte tyrosine kinase; also protein tyrosine kinase 1) is a glycoprotein member of the tyrosine protein kinase family, insulin receptor subfamily of proteins. There are multiple isoforms that run between 50 and 100 kDa in SDS-Page. It is reportedly expressed in lymphocytes and cerebral cortex neurons, plus cardiomyocytes where it plays a role in cellular hypertrophy. Mature human LTK is an 848 amino acid (aa) type I transmembrane protein that is embedded in the ER. It contains a 408 aa extracellular domain (aa 17-424) plus a 415 aa cytoplasmic region (aa 450-864). The cytoplasmic region possesses multiple phosphotyrosines that interact with downstream signaling molecules. There is also a protein kinase domain between aa 510-786. LTK apparently undergoes dimer- and trimerization under certain circumstances. There are multiple splice variants for LTK. Two isoforms possess a common deletion of aa 274-334 that may be accompanied by a 27 aa substitution for aa 449-544. Another isoform shows an alternative start site at Met406 accompanied by a 17 aa substitution for Val449, while a fourth isoform contains a 51 aa substitution for aa 171-864. A final 50 kDa isoform shows a 28 aa substitution for aa 449-864. Over aa 17-424, human LTK shares 75% aa identity with mouse LTK. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Immunogen | Synthetic peptide directed towards the N-terminal region of human LTK. Peptide sequence: GGGGRAYLRPRDRGRTQASPEKLENRSEAPGSGGRGGAAGGGGGWTSRAP The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Reactivity | Human, Guinea Pig, Rabbit |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS, 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.