Online Inquiry
LPAR3/LPA3/EDG-7 Antibody
SPA-07019
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | LPA3/EDG-7 |
| Gene Abbr. | LPAR3 |
| Gene ID | 23566 |
| Full Name | lysophosphatidic acid receptor 3 |
| Alias | EDG7, Edg-7, GPCR, HOFNH30, LP-A3 |
| Introduction | EDG7, a Lysophospholipid/Lysosphingolipid Receptor, was identified by RT-PCR from Jurkat T-cells. It is activated by unsaturated lysophosphatidic acid LPA. EDG7 has been reported in human prostate, as well as rodent brain, kidney, lung, placenta, prostate, and testis. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: MNECHYDKHMDFFYNRSNTDTVDDWTGTK. |
| Usage | |
|---|---|
| Application | WB, IF |
| Dilutions | Immunofluorescence (0.25-2 µg/mL) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human LPAR3/LPA3/EDG-7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.