Online Inquiry
LIF Antibody
SPA-06988
| Size | Price |
| 0.025 mg | Online Inquiry |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | LIF |
| Gene Abbr. | LIF |
| Gene ID | 3976 |
| Full Name | LIF interleukin 6 family cytokine |
| Alias | CDF, DIA, HILDA, MLPLI |
| Introduction | LIF (Leukemia inhibitory factor; also Differentiation-stimulating factor) is a 22 kDa (predicted) glycoprotein, member of the leukemia inhibitory factor/interleukin-6 (LIF/IL-6) family of cytokines. Natural LIF is heavily glycosylated, showing an apparent molecular weight of 32 kDa to 62 kDa, it is produced by a variety of cells including T cells, monocytes, fibroblasts, osteoblasts and mast cells. LIF induces hematopoietic differentiation in normal and myeloid leukemia cells, neuronal cell differentiation and stimulation of acute-phase protein synthesis in hepatocytes. Human LIF acts through a receptor comprising a 190 kDa LIF-binding alpha -chain and a 130 kDa signal-transducing beta -chain (gp130), which is shared with the other members of the IL-6 family. Human and mouse LIF exhibit 78% aa sequence identity. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEK. |
| Usage | |
|---|---|
| Application | IF, IHC |
| Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:50-1:200) |
| Reactivity | Human, Rat |
| Specificity | Specificity of human LIF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.