Leptin R Antibody - CD BioSciences

service-banner

Leptin R Antibody

Leptin R Antibody

SPA-06967

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name Leptin Receptor
Gene Abbr. LEPR
Gene ID 3953
Full Name leptin receptor
Alias CD295, LEP-R, LEPRD, OB-R, OBR
Introduction Leptin receptor (OB-R), also named B219, is a type I cytokine receptor family protein with significant amino acid sequence identity with gp130, G-CSF receptor, and the LIF receptor. Multiple isoforms of human and mouse OB-R, including a long form (OB-RL) with a large cytoplasmic domain capable of signal-transduction, and several receptor isoforms with short cytoplasmic domains (OB-Rs) lacking signal-transducing capabilities, have been identified. The extracellular domains of the short and long forms of OB-R are identical. An OB-R transcript lacking a transmembrane domain and potentially encoding a soluble form of the receptor has also been described. Circulating soluble OB-R, complexed to leptin, has been detected in mouse serum. Serum soluble OB-R levels have been shown to increase during pregnancy. OB-RL transcripts were reported to be expressed predominantly in regions of the hypothalamus previously thought to be important in body weight regulation. Expression of OB-Rs transcripts have been found in multiple tissues, including the choroid plexus, lung, kidney and primitive hematopoietic cell populations. OB-R has recently been shown to be encoded by the mouse diabetes (db) and rat fatty (fa) genes. Rodents homozygous for the db or fa mutations have been known to exhibit an obesity phenotype.

Mouse OB-R long form encodes a 1162 amino acid (aa) residue precursor protein with a 22 aa residue signal peptide, an 817 aa residue extracellular domain, a 21 aa residue transmembrane domain, and a 302 aa residue cytoplasmic domain. The extracellular domain of OB-R contains two hemopoietin receptor domains, a fibronectin type III domain and the WSXWS domain. Recombinant murine soluble OB-R has been shown to bind leptin with high affinity and is a potent leptin antagonist.

Tartaglia, L.A. et al. (1995) Cell 83:1263.
Cioffi, J.A. et al. (1996) Nature Medicine 2:585.
Lee, J.I. and J.M. Friedman (1996) Nature 379:632.
Tartaglia, L.A. (1997) J. Biol. Chem. 272:6093.
Gavrilova, O. et al. (1997) J. Biol. Chem. 272:30546.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: IYFPPKILTSVGSNVSFHCIYKKENKIVPSKEIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHHRYAEL.
Usage
Application IF, IHC
Dilutions Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:50-1:200)
Reactivity Human
Specificity Specificity of human Leptin R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.