Online Inquiry
Laminin S/Laminin beta 2 Antibody
SPA-06887
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Laminin |
| Gene Abbr. | LAMB2 |
| Gene ID | 3913 |
| Full Name | laminin subunit beta 2 |
| Alias | LAMS, NPHS5 |
| Introduction | Laminins are heterotrimeric, noncollagenous glycoproteins composed of alpha, beta and gamma chains. Through interactions with integrins, dystroglycan and other receptors, laminins critically contribute to cell differentation, cell shape and migration and maintenance of tissue phenotypes and survival. Laminin S, also known as laminin beta 2, is a subunit of laminin-3 (S-laminin), laminin-4 (S-merosin) and laminin-7 (KS-laminin). It is enriched in the basement membrane of muscles at the neuromuscular junctions, kidney glomerulus and vascular smooth muscle. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | CL2976 |
| Isotype | IgG1 |
| Immunogen | Recombinant Protein corresponding to amino acids: DLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPG. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (1 µg/mL); Immunohistochemistry (1:5000-1:10000) |
| Reactivity | Human |
| Validation | Knockdown Validated. |
| Specificity | Specificity of human Laminin S/Laminin beta 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.