Online Inquiry
Laminin alpha 4 Antibody
SPA-06883
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Laminin |
| Gene Abbr. | LAMA4 |
| Gene ID | 3910 |
| Full Name | laminin subunit alpha 4 |
| Alias | CMD1JJ, LAMA3, LAMA4*-1 |
| Introduction | Laminins are heterotrimeric glycoproteins and are major components of the basement membrane. Each laminin is comprised of a single alpha, beta, and gamma chain that heterotrimerize via their coiled-coil domains to form a large cruciform-shaped molecule. Mature Laminin alpha 4 is a subunit of Laminin 411, Laminin 421, and Laminin 423. Mature Laminin alpha 4 is a 1792 amino acid (aa) residue protein that has a Laminin N-terminal domain, four Laminin EGF-like domains, the coiled-coil domain, and five C‑terminal tandem Laminin G-like domains. The G-like domains contain binding sites for integrin, heparin, and dystroglycan. Within the region used as immunogen, mouse Laminin alpha 4 shows 91% and 97% aa sequence identity with human and rat Laminin alpha 4, respectively. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | LAMA4 (AAH04241.1, 1 a.a. - 120 a.a.) full-length human protein. MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL. |
| Usage | |
|---|---|
| Application | WB |
| Reactivity | Human |
| Specificity | LAMA4 - laminin, alpha 4. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.4). |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.