KIF6 Antibody - CD BioSciences

service-banner

KIF6 Antibody

KIF6 Antibody

SPA-06841

Size Price
0.1 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name KIF6
Gene Abbr. KIF6
Gene ID 221458
Full Name kinesin family member 6
Alias C6orf102, dJ1043E3.1, dJ137F1.4, dJ188D3.1
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: RKHQQGIYSIDEDEKLIPSLEIILPRDLADGFVNNKRESYKFKFQRIFDQDANQETVFENIAKPVAGSVL.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
Reactivity Human
Specificity Specificity of human KIF6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.