KDM4C/JMJD2C Antibody - CD BioSciences

service-banner

KDM4C/JMJD2C Antibody

KDM4C/JMJD2C Antibody

SPA-06759

Size Price
0.025 mL Online Inquiry
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name JMJD2B
Gene Abbr. KDM4C
Gene ID 23081
Full Name lysine demethylase 4C
Alias GASC1, JHDM3C, JMJD2C, TDRD14C
Introduction JMJD2C (Jumonji C domain-containing oxygenase D2C; also called GASC1, JHDM3C or KDM4C) belongs to JMJD2 family and is a histone demethylase for di- and trimethylated lysine 9 and 36 on histone H3 (H3K9me3/2 and H3K36me3/2). H3K9me3/2 is generally associated with transcriptional repression and heterochromatin formation, whereas, H3K36me3/2 is linked to transcriptionaly active genes where it plays a key role in suppression of incorrect transcription. JMJD2C regulates the expression of pluripotency genes including NOTCH1, NANOG, Sox2 and Pou5, and because of its dual role in modifying H3 either by removing the repressive H3K9me3/2 or the active H3K36me3/2 factor, JMJD2C has been considered a fine-tuning regulator of gene expression in normal development/differentiation as well as in carcinogenic progression. JMJD2C is overexpressed in aggressive, basal-like breast cancers compared with non basal-like breast cancers, and its overexpression has been shown to cause transformation of immortalized, non-transformed mammary epithelial cells and to regulate expression of genes responsible for stem cell phenotype/self-renewal in breast cancer cells. Moreover oncogenic role of JMJD2C has been documented in prostate cancer where it enhances the transcription of AR-dependent genes and cell proliferation by interaction with ligand-bound AR.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
Reactivity Human, Mouse, Rat
Specificity Specificity of human Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.