Online Inquiry
KCNJ15 Antibody
SPA-06825
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | KCNJ15 |
| Gene Abbr. | KCNJ15 |
| Gene ID | 3772 |
| Full Name | potassium inwardly rectifying channel subfamily J member 15 |
| Alias | IRKK, KIR1.3, KIR4.2 |
| Introduction | Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 1B2 |
| Isotype | IgG2A Kappa |
| Immunogen | KCNJ15 (NP_002234, 290 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKY. |
| Usage | |
|---|---|
| Application | WB, ELISA |
| Dilutions | Western Blot (1:500) |
| Reactivity | Human |
| Specificity | KCNJ15. |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.