Online Inquiry
Kallikrein 14 Antibody
SPA-06807
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Kallikrein |
| Gene Abbr. | KLK14 |
| Gene ID | 43847 |
| Full Name | kallikrein related peptidase 14 |
| Alias | KLK-L6 |
| Introduction | Kallikreins are a subgroup of serine proteases and are implicated in carcinogenesis. The novel KLK gene, KLK14 is expressed by both benign and malignant glandular epithelial cells, thus exhibiting an expression pattern similar to that of two other prostatic kallikreins, KLK2 and KLK3. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 2A7 |
| Isotype | IgG2B Kappa |
| Immunogen | KLK14 (NP_071329.1, 152 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRDK. |
| Usage | |
|---|---|
| Application | ELISA |
| Reactivity | Human |
| Specificity | KLK14 - kallikrein-related peptidase 14. |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.