Online Inquiry
JAMP Antibody
SPA-06689
| Size | Price |
| 0.025 mL | Online Inquiry |
| 0.1 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | JAMP |
| Gene Abbr. | JKAMP |
| Gene ID | 51528 |
| Full Name | JNK1/MAPK8 associated membrane protein |
| Alias | C14orf100, C24orf100, CDA06, HSPC213, HSPC327 |
| Introduction | JAMP, better known as the JNK1/MAPK8 associated membrane protein, is a regulator of MAPK8 activity in response to various stress stimuli. This regulation is part of a broader response to ER stress which induces JAMP to facilitate the degradation of misfolded ER luminal proteins via recruitment of the ERAD (endoplasmic reticulum-associated degradation system). Aside from interactions with MAPK8, JAMP also interacts with RNF5, as well as many regulatory proteins in the ERAD such as AMFR/GP78, CANX, PSMC1/PSMC2 and PSMC5-8. JAMP is expressed in many tissues, including brain, spleen, thymus, liver, kidney and testis. It also exhibits elevated expression in medulloblastomas. JAMP undergoes a post-translational modification after ubiquitination by RNF5 in a UBE2N-dependent manner, which ultimately decreases association with the proteasome and ERAD. Research has confirmed that JAMP regulates JNK-1 activity as well as optimizes ERAD to protect cells from unfolded proteins which may have various implications in disease models. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: LYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTH. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:20-1:50) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human JAMP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.