ITGB1BP3 Antibody - CD BioSciences

service-banner

ITGB1BP3 Antibody

ITGB1BP3 Antibody

SPA-06632

Size Price
100 µL Online Inquiry
20 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name ITGB1BP3
Gene Abbr. NMRK2
Gene ID 27231
Full Name nicotinamide riboside kinase 2
Alias ITGB1BP3, MIBP, NRK2
Introduction The neuromedin B receptor, a Bombesin Receptor, activates phospholipase and protein kinase C and enhances calcium mobilization. It binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissues. Neuromedin B receptor expression has been reported in brain, particularly the olfactory bulb and thalamus, and in colon, liver, placenta, testis, spinal cord, and gastrointestinal tract. In addition, it has been shown to be present in cancer of the lung, ovary, and prostate.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: VYLDGMKSREELFREVLEDIQNSLLNRSQESAPSPARPARTQGPGRGCGHRTARPAASQQDSM.
Usage
Application IHC
Dilutions Immunohistochemistry (1:200-1:500)
Reactivity Human
Specificity Specificity of human ITGB1BP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.