Online Inquiry
ITGB1BP3 Antibody
SPA-06632
| Size | Price |
| 100 µL | Online Inquiry |
| 20 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | ITGB1BP3 |
| Gene Abbr. | NMRK2 |
| Gene ID | 27231 |
| Full Name | nicotinamide riboside kinase 2 |
| Alias | ITGB1BP3, MIBP, NRK2 |
| Introduction | The neuromedin B receptor, a Bombesin Receptor, activates phospholipase and protein kinase C and enhances calcium mobilization. It binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissues. Neuromedin B receptor expression has been reported in brain, particularly the olfactory bulb and thalamus, and in colon, liver, placenta, testis, spinal cord, and gastrointestinal tract. In addition, it has been shown to be present in cancer of the lung, ovary, and prostate. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to the following amino acid sequence: VYLDGMKSREELFREVLEDIQNSLLNRSQESAPSPARPARTQGPGRGCGHRTARPAASQQDSM. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:200-1:500) |
| Reactivity | Human |
| Specificity | Specificity of human ITGB1BP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.