Online Inquiry
ITGB1BP3 Antibody
SPA-06630
| Size | Price |
| 100 µL | Online Inquiry |
| 20 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | ITGB1BP3 |
| Gene Abbr. | NMRK2 |
| Gene ID | 27231 |
| Full Name | nicotinamide riboside kinase 2 |
| Alias | ITGB1BP3, MIBP, NRK2 |
| Introduction | The neuromedin B receptor, a Bombesin Receptor, activates phospholipase and protein kinase C and enhances calcium mobilization. It binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissues. Neuromedin B receptor expression has been reported in brain, particularly the olfactory bulb and thalamus, and in colon, liver, placenta, testis, spinal cord, and gastrointestinal tract. In addition, it has been shown to be present in cancer of the lung, ovary, and prostate. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to ITGB1BP3(integrin beta 1 binding protein 3) The peptide sequence was selected from the middle region of ITGB1BP3. Peptide sequence YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:100-1:2000) |
| Reactivity | Human, Rat, Porcine, Zebrafish |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.