ITGB1BP3 Antibody - CD BioSciences

service-banner

ITGB1BP3 Antibody

ITGB1BP3 Antibody

SPA-06630

Size Price
100 µL Online Inquiry
20 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name ITGB1BP3
Gene Abbr. NMRK2
Gene ID 27231
Full Name nicotinamide riboside kinase 2
Alias ITGB1BP3, MIBP, NRK2
Introduction The neuromedin B receptor, a Bombesin Receptor, activates phospholipase and protein kinase C and enhances calcium mobilization. It binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissues. Neuromedin B receptor expression has been reported in brain, particularly the olfactory bulb and thalamus, and in colon, liver, placenta, testis, spinal cord, and gastrointestinal tract. In addition, it has been shown to be present in cancer of the lung, ovary, and prostate.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to ITGB1BP3(integrin beta 1 binding protein 3) The peptide sequence was selected from the middle region of ITGB1BP3. Peptide sequence YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Dilutions Western Blot (1:100-1:2000)
Reactivity Human, Rat, Porcine, Zebrafish
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.