Online Inquiry
ITFG3 Antibody
SPA-06627
| Size | Price |
| 0.1 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | ITFG3 |
| Gene Abbr. | FAM234A |
| Gene ID | 83986 |
| Full Name | family with sequence similarity 234 member A |
| Alias | C16orf9, ITFG3, gs19 |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to ITFG3 (integrin alpha FG-GAP repeat containing 3) The peptide sequence was selected from the middle region of ITFG3)(50ug). Peptide sequence RSAFFFWGLHELGSTSETETGEARHSLYMFHPTLPRVLLELANVSTHIVA. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:100-1:2000) |
| Reactivity | Human |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.