Online Inquiry
IRF-8 Antibody
SPA-06572
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | IRF-8 |
| Gene Abbr. | IRF8 |
| Gene ID | 3394 |
| Full Name | interferon regulatory factor 8 |
| Alias | H-ICSBP, ICSBP, ICSBP1, IMD32A, IMD32B |
| Introduction | IRF8 (interferon regulatory factor 8; also ICSBP) is a 50 kDa member of the IRF family of proteins. It is expressed in myeloid, dendritic and B cells and interacts with PU.1 to regulate the expression of TLR4, IL-18, IL-12p35, and PTPN13, a Fas-associated phosphatase that blocks Fas-induced apoptosis. Human IRF8 is 426 amino acids (aa) in length. It contains an N-terminal DNA-binding basic region (aa 9-110) and at least one regulatory phosphorylation site at Tyr95. Over aa 255-426, human IRF8 shares 90% and 88% aa sequence identity with canine and mouse IRF8, respectively. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: PDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYY. |
| Usage | |
|---|---|
| Application | WB, IF, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:200-1:500) |
| Reactivity | Human |
| Specificity | Specificity of human IRF8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.