IL-28R alpha/IFN-lambda R1 Antibody - CD BioSciences

service-banner

IL-28R alpha/IFN-lambda R1 Antibody

IL-28R alpha/IFN-lambda R1 Antibody

SPA-06488

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name Interferon Receptor
Gene Abbr. IFNLR1
Gene ID 163702
Full Name interferon lambda receptor 1
Alias CRF2/12, IFNLR, IL-28R1, IL28RA, LICR2
Introduction IL28RA is a class II cytokine receptor that interacts with IL10RB to bind IL28A, IL28B, and IL29, which are related to type I interferons. These ligands play a critical role in response to microbial challenge and activate the JAK/STAT signaling system. It heterodimers with IL10RB. There are 4 isoforms as result of alternative splicing. It is widely expressed. IL28RA belongs to the type II cytokine receptor family, and contains 1 fibronectin type III domain.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to IL28RA(interleukin 28 receptor, alpha (interferon, lambda receptor)) The peptide sequence was selected from the N terminal of IL28RA. Peptide sequence EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Dilutions Western Blot (1:100-1:2000)
Reactivity Human, Rat, Bovine, Canine, Guinea Pig
Specificity This product is specific to Subunit or Isoform: alpha.
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.