Online Inquiry
IL-28R alpha/IFN-lambda R1 Antibody
SPA-06488
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Interferon Receptor |
| Gene Abbr. | IFNLR1 |
| Gene ID | 163702 |
| Full Name | interferon lambda receptor 1 |
| Alias | CRF2/12, IFNLR, IL-28R1, IL28RA, LICR2 |
| Introduction | IL28RA is a class II cytokine receptor that interacts with IL10RB to bind IL28A, IL28B, and IL29, which are related to type I interferons. These ligands play a critical role in response to microbial challenge and activate the JAK/STAT signaling system. It heterodimers with IL10RB. There are 4 isoforms as result of alternative splicing. It is widely expressed. IL28RA belongs to the type II cytokine receptor family, and contains 1 fibronectin type III domain. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to IL28RA(interleukin 28 receptor, alpha (interferon, lambda receptor)) The peptide sequence was selected from the N terminal of IL28RA. Peptide sequence EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:100-1:2000) |
| Reactivity | Human, Rat, Bovine, Canine, Guinea Pig |
| Specificity | This product is specific to Subunit or Isoform: alpha. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.