IFN-alpha/beta R1 Antibody - CD BioSciences

service-banner

IFN-alpha/beta R1 Antibody

IFN-alpha/beta R1 Antibody

SPA-06478

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name Interferon Receptor
Gene Abbr. IFNAR1
Gene ID 3454
Full Name interferon alpha and beta receptor subunit 1
Alias AVP, IFN-alpha-REC, IFNAR, IFNBR, IFRC
Introduction Type I interferons (IFN-alpha, IFN-beta, IFN-omega ) bind to the type I IFN receptor, also called the IFN alpha/beta receptor. This receptor is composed of two chains, IFN-alpha/beta R1 and R2.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: NISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV.
Usage
Application IHC
Dilutions Immunohistochemistry (1:20-1:50)
Reactivity Human
Specificity Specificity of human IFN-alpha/beta R1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.