Online Inquiry
HVEM/TNFRSF14 Antibody
SPA-10860
| Size | Price |
| 0.1 mg | Online Inquiry |
| 0.025 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | TNF receptor |
| Gene Abbr. | TNFRSF14 |
| Gene ID | 8764 |
| Full Name | TNF receptor superfamily member 14 |
| Alias | ATAR, CD270, HVEA, HVEM, LIGHTR |
| Introduction | Tumor necrosis factor receptor (TNFR) superfamily members are defined by cysteine-rich domains in their extracellular regions that bind TNF-related ligands that share a common structural homology in their extracellular domain. TNFRSF14 was initially identified as the Herpesvirus entry mediator and upon binding to the herpes simplex virus (HSV) envelope glycoprotein D or either of its natural ligands LIGHT and lymphotoxin alpha (LT), activates the transcription factors NF-kappaB and AP-1. Activation of this signal transduction pathway in T cells stimulates T cell proliferation and cytokine production, leading to inflammation and enhanced CTL-mediated tumor immunity, suggesting that these proteins may be useful as potential targets for controlling cellular immune responses. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: PPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCD. |
| Usage | |
|---|---|
| Application | IF, IHC |
| Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:20-1:50) |
| Reactivity | Human |
| Specificity | Specificity of human HVEM/TNFRSF14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.