HO-1/HMOX1/HSP32 Antibody - CD BioSciences

service-banner

HO-1/HMOX1/HSP32 Antibody

HO-1/HMOX1/HSP32 Antibody

SPA-05214

Size Price
0.05 mg Online Inquiry
0.2 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name HO-1/HSP32
Gene Abbr. HMOX1
Gene ID 3162
Full Name heme oxygenase 1
Alias HMOX1D, HO-1, HSP32, bK286B10
Introduction HO-1 (also know as Heme oxygenase-1, HMOX1, HSP32), a member of the heme oxygenase family, is an enzyme for heme catabolism and cleaves heme to form biliverdin. This inducible protein reacts from hypoxia, cytokines, and oxidative stress. HO-1 is itself an antioxidant that protects cells from ROS (reactive oxygen species) by regulating ROS levels. HO-1 has been shown to inhibit the pathogenesis of immune related inflammatory diseases as well as cardiovascular disease (CVD).
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: QDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ.
Usage
Application WB, IHC
Dilutions Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:500-1:1000)
Reactivity Human
Specificity Specificity of human HO-1/HMOX1/HSP32 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.