Online Inquiry
HO-1/HMOX1/HSP32 Antibody
SPA-05214
Size | Price |
0.05 mg | Online Inquiry |
0.2 mg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | HO-1/HSP32 |
Gene Abbr. | HMOX1 |
Gene ID | 3162 |
Full Name | heme oxygenase 1 |
Alias | HMOX1D, HO-1, HSP32, bK286B10 |
Introduction | HO-1 (also know as Heme oxygenase-1, HMOX1, HSP32), a member of the heme oxygenase family, is an enzyme for heme catabolism and cleaves heme to form biliverdin. This inducible protein reacts from hypoxia, cytokines, and oxidative stress. HO-1 is itself an antioxidant that protects cells from ROS (reactive oxygen species) by regulating ROS levels. HO-1 has been shown to inhibit the pathogenesis of immune related inflammatory diseases as well as cardiovascular disease (CVD). |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: QDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ. |
Usage | |
---|---|
Application | WB, IHC |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:500-1:1000) |
Reactivity | Human |
Specificity | Specificity of human HO-1/HMOX1/HSP32 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.