Online Inquiry
Growth Hormone Antibody
SPA-04843
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Growth Hormone |
Gene Abbr. | GH1 |
Gene ID | 2688 |
Full Name | growth hormone 1 |
Alias | GH, GH-N, GHB5, GHN, IGHD1A |
Introduction | The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature. [provided by RefSeq] |
Product Details | |
---|---|
Host | Mouse |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | GH1 (NP_000506, 1 a.a. - 217 a.a.) full-length human protein. MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF. |
Usage | |
---|---|
Application | WB |
Reactivity | Human |
Specificity | GH1 - growth hormone 1. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.4). |
Preservative | No Preservative |
Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.