Online Inquiry
GNB3 Antibody
SPA-04263
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | G protein |
| Gene Abbr. | GNB3 |
| Gene ID | 2784 |
| Full Name | G protein subunit beta 3 |
| Alias | CSNB1H |
| Introduction | Heterotrimeric guanine nucleotide-binding proteins, G proteins, transduce ligand binding to G protein-coupled receptors (GPCRs) into intracellular responses. G proteins are comprised of 3 subunits, alpha beta and gamma. Upon activation of GPCRs, the receptor promotes the exchange of GDP to GTP of Gα, changing the confirmation of the switch regions within Gα. The receptor bound heterotimeric G protein (inactive) is then released, and dissociates into the GTP-bound Gα (active) monomer and the Gβ/Gγ heterodimer. Gα activates adenylyl cyclase, which converts ATP to the second messenger cAMP. Gα also activates phosphoinositide-specific phospholipase C (PLC), which catalyzes hydrolysis of the phospholipid of phosphatidylinositol 4,5-biphosphate (PIP2), releasing the second messengers IP3 and 1,2-diacylglycerol (DAG). IP3 activates IP3 receptors to release Ca2+ from the ER. DAG is an activator of protein kinase C (PKC), which in turn activates the Erk1/2 pathway. The primary function of the Gβ/Gγ heterodimer is to inhibit Gα, although it may also activate second messengers (e.g. PLC pathway) or gate ion channels (e.g. GIRK). Guanine nucleotide-binding protein b3 (GNB3) is an isoform of the b subunit. Research studies have shown that a polymorphism in the GNB3 gene, C825T, is associated with hypertension, obesity, and depression. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Immunogen | Synthetic peptide directed towards the C-terminal region of Human GNB3. Peptide sequence: SIICGITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNRVSC The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| MW(KDa) | 31 |
| Reactivity | Human |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS, 2% sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.