Online Inquiry
GIT-2 Antibody
SPA-04485
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | GIT-2 |
| Gene Abbr. | GIT2 |
| Gene ID | 9815 |
| Full Name | GIT ArfGAP 2 |
| Alias | CAT-2, CAT2, PKL |
| Introduction | G protein-coupled receptor. Once at the focal adhesion, GIT-2 is thought to play a key role in cell polarity and migration, making it a protein of interest in the investigation of oncogenic signaling pathways. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 1B2 |
| Isotype | IgG1 Kappa |
| Immunogen | GIT2 (NP_055591, 401 a.a. ~ 498 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TDLETTASKTNRQKLQTLQSENSNLRKQATTNVYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMRLQPFPAHA. |
| Usage | |
|---|---|
| Application | WB, ELISA |
| MW(KDa) | 85 |
| Reactivity | Human |
| Specificity | Reacts with G protein-coupled receptor kinase interacting ArfGAP 2. |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.