Online Inquiry
GFR alpha-1/GDNF R alpha-1 Antibody
SPA-04391
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | GDNF Receptor |
Gene Abbr. | GFRA1 |
Gene ID | 2674 |
Full Name | GDNF family receptor alpha 1 |
Alias | GDNFR, GDNFRA, GFR-ALPHA-1, RET1L, RETL1 |
Introduction | Glial cell line-derived growth factor (GDNF), neurturin (NTN), artemin and persephin are distant members of the TGF-beta superfamily. They function as neurotrophic factors for a variety of neuronal populations in the central and peripheral nervous systems. The bioactivities of GDNF and NTN are mediated through a receptor complex composed of the non ligand-binding signaling subunit (c-Ret receptor tyrosine kinase) and either of two ligand binding subunits [GDNF receptor alpha -1 (GFR alpha -1) or GFR alpha -2]. GFR alpha -1 and -2 are members of a family of at least four cysteine-rich glycosyl-phosphatidylinositol (GPI)-linked cell surface proteins that share conserved placements of many of their cysteine residues. Binding of GDNF to membrane-associated GFR alpha -1 or GFR alpha -2 initiates the association with and activation of the Ret tyrosine kinase. Soluble GFR alpha s released enzymatically from the cell surface-associated protein with phosphatidylinositol phospholipase C, as well as recombinantly produced soluble GFR alpha -1, can also bind with high-affinity to GDNF and trigger the activation of Ret tyrosine kinase. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: IGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLK. |
Usage | |
---|---|
Application | IF, IHC |
Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:200-1:500) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human GFR alpha-1/GDNF R alpha-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.