Online Inquiry
Gα 12 Antibody
SPA-04192
| Size | Price |
| 100 µL | Online Inquiry |
| 20 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | G protein |
| Gene Abbr. | GNA12 |
| Gene ID | 2768 |
| Full Name | G protein subunit alpha 12 |
| Alias | NNX3, RMP, gep |
| Introduction | Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to GNA12(guanine nucleotide binding protein (G protein) alpha 12) The peptide sequence was selected from the middle region of GNA12. Peptide sequence TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:100-1:2000) |
| Reactivity | Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit |
| Specificity | This product is specific to Subunit or Isoform: alpha-12. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.