DUSP27 Antibody - CD BioSciences

service-banner

DUSP27 Antibody

DUSP27 Antibody

SPA-03123

Size Price
100 µL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name DUSP27
Gene Abbr. DUSP27
Gene ID 92235
Full Name dual specificity phosphatase 27, atypical
Alias DUSP27
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: EALMTVRKKRAIYPNEGFLKQLRELNEKLMEER.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
Reactivity Human, Mouse, Rat
Specificity Specificity of human DUSP27 dual specificity phosphatase 27 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.