DUSP26 Antibody - CD BioSciences

service-banner

DUSP26 Antibody

DUSP26 Antibody

SPA-03120

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name DUSP26
Gene Abbr. DUSP26
Gene ID 78986
Full Name dual specificity phosphatase 26
Alias DSP-4, DUSP24, LDP-4, LDP4, MKP-8
Introduction MGC1136 is classified as a dual specificity MAP kinase phosphatase.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the middle region of mouse DUSP26. Peptide sequence: TACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHNRWRGTPEAY The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Reactivity Mouse
Storage & Handling
Storage Buffer PBS, 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.