DUSP10/MKP5 Antibody - CD BioSciences

service-banner

DUSP10/MKP5 Antibody

DUSP10/MKP5 Antibody

SPA-03055

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name DUSP10/MKP5
Gene Abbr. DUSP10
Gene ID 11221
Full Name dual specificity phosphatase 10
Alias MKP-5, MKP5
Introduction MAP kinases are inactivated by dual-specificity protein phosphatases (DUSPs) that differ in their substrate specificity, tissue distribution, inducibility by extracellular stimuli, and cellular localization. DUSPs, also known as MAPK phosphatases (MKP), specifically dephosphorylate both threonine and tyrosine residues in MAPK P-loops and have been shown to play important roles in regulating the function of the MAPK family. At least 13 members of the family (DUSP1-10, DUSP14, DUSP16, and DUSP22) display unique substrate specificities for various MAP kinases. MAPK phosphatases typically contain an amino-terminal rhodanese-fold responsible for DUSP docking to MAPK family members and a carboxy-terminal catalytic domain. These phosphatases can play important roles in development, immune system function, stress responses, and metabolic homeostasis. In addition, research studies have implicated DUSPs in the development of cancer and the response of cancer cells to chemotherapy.DUSP10, or MKP5, selectively phosphorylates and inactivates p38α MAP kinase and JNK, but does not appear to affect p44/42 MAPK. Activated JNK phosphorylates the ATF2 transcription factor during periods of oxidative stress, which induces expression of DUSP10 and related phosphatases. Increased DUSP10 activity helps to further coordinate JNK activity during the stress response. Studies using DUSP10 deficient mice demonstrated a likely role of this phosphatase in both the adaptive and innate immune responses.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: FMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQ.
Usage
Application IF, IHC
Dilutions Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:20-1:50)
MW(KDa) 54
Reactivity Human, Mouse, Rat
Specificity Specificity of human DUSP10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.